Cytokeratin 5 Mouse Monoclonal Antibody
Cat Number: | MAB-94762 |
---|---|
Conjugate: | Unconjugated |
Size: | 200 ug |
Clone: | 5D3FT |
Concentration: | 1mg/ml |
Host: | Mouse |
Isotype: | IgG2b |
Immunogen: | A synthetic peptide corresponding to a sequence in the middle region of human Cytokeratin 5 (286-317aa KVELEAKVDALMDEINFMKMFFDAELSQMQTH), different from the related mouse sequence by one amino acid, and identical to the related rat sequence. |
Reactivity: | Human |
Applications: | Western blot, 0.5-1 ug/ml Immunohistochemistry (Paraffin-embedded Section): 4-10 ug/ml Immunocytochemistry: 10 ug/ml Immunofluorescence,: 10 ug/ml Immunofluorescence, 10 ug/ml Flow Cytometry: 1-3 ug/1x106 cells |
Molecular: | 62 kDa |
Purification: | Immunogen affinity purified. |
Background: | Cytokeratin 5, also known as KRT5, K5, or CK5, is a protein that is encoded in humans by the KRT5 gene. The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the basal layer of the epidermis with family member KRT14. Mutations in these genes have been associated with a complex of diseases termed epidermolysis bullosa simplex. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. |
Form: | Lyophilized: Add 0.2ml distilled water to obtain a concentration of 1mg/ml |
Buffer: | Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4. |
Storage: | At -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freezing and thawing. |