Top

EWSR1

Cat Number: AB-84177
Size: 100 ug
Clone: POLY
Concentration: 1mg/ml
Host: Rb
Isotype: IgG
Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human EWSR1. (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.
Reactivity: Hu, Ms, Rt
Applications: Western blot: 1:2000-1:10.000 Immunohistochemistry(Paraffin-embedded Section): 1:1000-1:2000 Immunohistochemistry(Frozen Section): 1:1000-1:2000 Immunocytochemistry: 1:500 Immunofluorescence: 1:500 Flow Cytometry: 1-3μg/1x106 cells, Human
Purification: Aff. Pur.
Background:

This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

Form: Liquid
Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Storage: At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid repeated freezing and thawing.